<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NY_M31 M31 France 2000 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, K14R, I15V, K20T, E35D, M36I, R41K, K45KR, H69K, L89IM  
>M31| codons 1-99
PQITLWQRPLVTVRVGGQLTEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNIMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R   Y181C, Y188L   V35T, E40D, V60I, K122E, I135L, S162H, K173I, Q174K, D177E, I178M, V179M, T200A, Q207K, R211S, H221HY, K223KT W24WR
>M31| codons 16-239
MDGPKVKQRPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPIFAIKRKDSTKWRKLV
DFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSL
NNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRIKNPEMMICQYMDDLLVGSDLEI
GQHRAKIEELRKHLLSWGFTTPDKKYQTEPPFLWMGYELHPDKW

References
Author Title Citation
Yahi, N Use of drug resistance sequence data for the systematic detection of non-B human immunodeficiency virus type 1 (HIV-1) subtypes: How to create a sentinel site for monitoring the genetic diversity of HIV-1 at a country scale. J Infect Dis, 2001