<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NY_M29 M29 France 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ 3TC+ D4T NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215F       V35T, E36A, T39K, K43E, K49KR, E53D, T69S, D121H, K122E, D123S, I142V, S162D, K173S, Q174K, D177E, Q207A  
>M29| codons 16-239
MDGPKVKQWPLTEEKIKALTAICKELEEEGKISRIGPDNPYNTPVFAIKKKDSSKWRKLV
DFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLHESFRKYTAFTIPSI
NNETPGVRYQYNVLPQGWKGSPAIFQDSMTKILEPFRSKNPEIVIYQYVDDLYVGSDLEI
GQHRTKIEELRAHLLRWGFFTPDKKHQKEPPFLWMGYELHPDKW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82F   L10I, I13V, I15V, K20KI, E35D, M36I, R41K, D60E, I62IV, H69Q, L89I  
>M29| codons 1-99
PQITLWQRPIVTVKVGGQLIEALLDTGADDTVLEDINLPGKWKPKIIGGIGGFVKVRQYE
QVLIEICGQKAIGTVLVGPTPFNIIGRNILTQIGCTLNF

References
Author Title Citation
Yahi, N Use of drug resistance sequence data for the systematic detection of non-B human immunodeficiency virus type 1 (HIV-1) subtypes: How to create a sentinel site for monitoring the genetic diversity of HIV-1 at a country scale. J Infect Dis, 2001