<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NY_M28 M28 France 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ NFV+ 3TC NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, T39K, D121H, K122E, D123S, K166KR, E169ED, K173LS, Q174KR, D177E, V179VI, G196E, Q207AD, R211K  
>M28| codons 30-239
KIKALTEICKEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLHESFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPAIFQSSMTRILDPFRLKNPEIIIYQYVDDLYVGSDLEIEQHRTKIEELRAHL
LKWGFTTPDKKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Yahi, N Use of drug resistance sequence data for the systematic detection of non-B human immunodeficiency virus type 1 (HIV-1) subtypes: how to create a sentinel site for monitoring the genetic diversity of HIV-1 at a country scale. J Infect Dis, 2001