<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10M, I15V, L19T, E35D, M36I, R41K, Q61E, L63P, H69K, L89M, I93L  
>PG41| codons 1-99
PQITLWQRPMVTIKVGGQTKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
EIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179D V35T, E36A, T39D, S48T, K122E, T165I, Q174K, G196E, T200A, I202V, Q207A, R211K, F214L, V245Q  
>PG41| codons 1-248
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKKNPDIDI
YQYMDDLYVGSDLEIEQHRAKVEELRAHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPE

References
Author Title Citation
Parreira, R Genetic characterization of human immunodeficiency virus type 1 from Beira, Mozambique Microbes Infect, 2006