<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NY_M27 M27 France 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI+ 3TC NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L210W, T215Y D67E Y181C, G190A   V21I, V35T, T39TA, K101Q, D121H, K122E, K173S, Q174R, D177E, I178M, G196GE, T200TI, Q207N, R211RK, L228H  
>M27| codons 16-239
MDGPKIKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPVFAIKKKESTKWRKLV
DFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSI
NNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSRNPEMVICQYMDDLYVASDLEI
EQHRIKIEELRNHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKW

References
Author Title Citation
Yahi, N Use of drug resistance sequence data for the systematic detection of non-B human immunodeficiency virus type 1 (HIV-1) subtypes: How to create a sentinel site for monitoring the genetic diversity of HIV-1 at a country scale. J Infect Dis, 2001