<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NY_M25 M25 France 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI+ 3TC NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L210W, T215Y       V21I, E28K, K32E, V35T, T39TK, V60VI, K64R, T69S, D121HY, K122E, I135T, I142V, E169D, K173A, Q174K, D177E, I178L, V179I, G196E, T200A, E204K, Q207A, R211S K166K*
>M25| codons 16-239
MDGPKIKQWPLTKEKIEALTEICKEMEKEGKISKIGPENPYNTPIFAIRKKDSSKWRKLV
DFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPST
NNETPGVRYQYNVLPQGWKGSPAIFQSSMT*ILDPFRAKNPELIIYQYMDDLYVGSDLEI
EQHRAKIEKLRAHLWSWGFYTPDKKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Yahi, N Use of drug resistance sequence data for the systematic detection of non-B human immunodeficiency virus type 1 (HIV-1) subtypes: How to create a sentinel site for monitoring the genetic diversity of HIV-1 at a country scale. J Infect Dis, 2001