<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NY_M23 M23 France 2000 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I15V, E35D, M36I, N37ND, R41K, L63P, I64M, H69K, L89M, I93L  
>M23| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QIPMEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35IT, T39N, E40D, D121DY, K122E, I135T, S162C, K173T, Q174K, Q207A, R211S  
>M23| codons 16-239
MDGPKVKQWPLTEEKIKALIEICNDMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLV
DFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPST
NNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTKNPDIVIYQYMDDLYVGSDLEI
GQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Yahi, N Use of drug resistance sequence data for the systematic detection of non-B human immunodeficiency virus type 1 (HIV-1) subtypes: How to create a sentinel site for monitoring the genetic diversity of HIV-1 at a country scale. J Infect Dis, 2001