<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        S134C, D177E, T200A, Q207N, R211K, A272P, A288S, E297K, E300D, G333D, V365I, A376T, T386L, K390R, E399D, L452A I135P
>J350_PR_RT_CN| codons 1-466
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPCPNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRNHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTEVIPLTKEAD
LELAENREILKEPVHGVYYDPSKDLIAEIQKQDQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDIKQLTEAVQKITTESIVIWGKLPKFRLPIQKETWDAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKAGKAGYVTDRGRQKV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, G16E, N37A, P39S, R41K, I62K, L63V, V77I, I93L  
>J350_PR_RT_CN| codons 1-99
PQITLWQRPIVTIKIEGQLKEALLDTGADDTVLEEMALSGKWKPKMIGGIGGFIKVRQYD
QKVIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Santos, AF Primary HIV-1 drug resistance in the C-terminal domains of viral reverse transcriptase among drug-naive patients from southern Brazil J Clin Virol, 2011