<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I15V, G16E, K20R, M36I, N37K, P39S, R41N, L63T, H69K, I93L  
>J162_PR_RT| codons 1-99
PQITLWQRPVVTIKVEGQLREALLDTGADDTVLEEIKLSGNWKPKMIGGIGGFIKVRQYD
QITIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  K219KN     V35T, T39D, K122E, I135T, K173A, D177E, T200A, Q207E, R211K  
>J162_PR_RT| codons 1-244
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICDEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDNKHQKEPPFLWMGYELHPDKWT
VQPI

References
Author Title Citation
Santos, AF Primary HIV-1 drug resistance in the C-terminal domains of viral reverse transcriptase among drug-naive patients from southern Brazil J Clin Virol, 2011