<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NY_M18 M18 France 1999 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11I T12K, I13A, K14R, K20I, M36I, R41K, L63Q, H69K, L89M  
>M18| codons 1-99
PQITLWQRPLIKARIGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIQIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E40D, K49R, I135V, S162A, F171Y, K173T, Q174K, D177E, T200A, I202V, Q207E, R211K  
>M18| codons 16-239
MDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPVFAIKKKDSTKWRKLV
DFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSV
NNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPYRTKNPEIVIYQYMDDLYVGSDLEI
GQHRAKVEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Yahi, N Use of drug resistance sequence data for the systematic detection of non-B human immunodeficiency virus type 1 (HIV-1) subtypes: How to create a sentinel site for monitoring the genetic diversity of HIV-1 at a country scale. J Infect Dis, 2001