<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NY_M15 M15 France 2000 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 PI NA
2 3TC+ABC+AZT+NVP 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L89V L10V, I13V, K14R, L19P, K20I, E35N, M36I, N37D, R41K, H69K, T74S  
>M15| codons 1-99
PQITLWQRPVVTVRIGGQPIEALLDTGADDTVLENIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGSVLVGPTPVNIIGRNVLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215Y K219E Y181C A98AG V35T, E40D, E44EA, K49R, V60I, I135V, S162A, K173T, Q174E, D177E, I178M, T200A, E203D, E204K, Q207E, R211HQ, H221Y  
>M15| codons 16-239
MDGPKVKQWPLTEEKIKALTEICTDLEKAGKISRIGPENPYNTPIFAIKKKNSTRWRKLV
DFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSV
NNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTENPEMVICQYVDDLYVGSDLEI
GQHRAKIDKLREHLLHWGFYTPDEKYQKEPPFLWMGYELHPDKW

References
Author Title Citation
Yahi, N Use of drug resistance sequence data for the systematic detection of non-B human immunodeficiency virus type 1 (HIV-1) subtypes: How to create a sentinel site for monitoring the genetic diversity of HIV-1 at a country scale. J Infect Dis, 2001