<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NY_M4 M4 France 1999 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184MV       V35T, E36A, T39E, K43R, S48T, E53D, K122E, D123S, I135T, I142V, K173AS, D177E, T200A, Q207E, R211K, T215X, L228H, K238R  
>M4| codons 16-239
MDGPKVKQWPLTEEKIKALTAICEELEREGKITKIGPDNPYNTPVFAIKKKDSTKWRKLV
DFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPST
NNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVIYQYVDDLYVGSDLEI
GQHRAKIEELREHLLKWGFXTPDKKHQKEPPFHWMGYELHPDRW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, H69K, L89M, I93L C95CY
>M4| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGYTLNF

References
Author Title Citation
Yahi, N Use of drug resistance sequence data for the systematic detection of non-B human immunodeficiency virus type 1 (HIV-1) subtypes: How to create a sentinel site for monitoring the genetic diversity of HIV-1 at a country scale. J Infect Dis, 2001