<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NY_M3 M3 France 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 DDC+ 3TC NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10M, T12S, I15V, N37S, L63T, H69K, K70Q, L89M, I93L  
>M3| codons 1-99
PQITLWQRPMVSIKVGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QITIEICGKQAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     K20KR, V35T, E36A, T39E, E40D, K43R, T69TN, K122E, D123S, A158S, K173A, Q174QR, D177DE, T200A, E203EK, Q207E, R211K, F214L, D218DE, L228H  
>M3| codons 16-239
MDGPRVKQWPLTEEKIKALTAICEDMEREGKISKIGPENPYNTPVFAIKKKNSNRWRKLV
DFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSI
NNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRARNPEIVIYQYVDDLYVGSDLEI
GQHRAKIKELREHLLKWGLTTPEQKHQKEPPFHWMGYELHPDKW

References
Author Title Citation
Yahi, N Use of drug resistance sequence data for the systematic detection of non-B human immunodeficiency virus type 1 (HIV-1) subtypes: How to create a sentinel site for monitoring the genetic diversity of HIV-1 at a country scale. J Infect Dis, 2001