<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NY_M1 M1 France 1999 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, M36I, N37S, R41K, L63P, H69K, V75I, V82I, L89M, I93L  
>M1| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEISLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTILVGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V     E138K V35T, E36A, T39D, K43KE, R83K, F87FL, E89X, K101R, K102R, K122V, D123G, K173A, D177E, G196K, T200A, I202V, Q207G, R211K, L228LV  
>M1| codons 16-236
MDGPKVKQWPLTEEKIKALTAICDEMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLV
DFRELNKKTQDLWDVQLGIPHPAGLRRKKSVTVLDVGDAYFSVPLDVGFRKYTAFTIPSI
NNKTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVIYQYVDDLYVGSDLEI
KQHRAKVEELRGHLLKWGFTTPDKKHQKEPPFVWMGYELHP

References
Author Title Citation
Yahi, N Use of drug resistance sequence data for the systematic detection of non-B human immunodeficiency virus type 1 (HIV-1) subtypes: How to create a sentinel site for monitoring the genetic diversity of HIV-1 at a country scale. J Infect Dis, 2001