<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
C03-2066174-1 C03-2066174-1 Japan 2004 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, G16AE, E35D, M36I, R41K, K45KR, R57K, I62IV, L63LP, H69K, V77I, L89M  
>C03-2066174-1| codons 1-99
PQITLWQRPVVTVKIEGQLKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
QVPIEICGKKAIGTVLIGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, K20R, V35T, K122E, D123NS, K173S, D177EG, V179I, T200A, I202V, Q207G, R211K, D250E T39HQ
>C03-2066174-1| codons 1-263
PISPIETVPVTLKPGMDGPRVKQWPLTEEKIKALTEICQEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSQNPGIII
YQYMDDLYVGSDLEIGQHRAKVEELRGHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGK

References
Author Title Citation
Gatanaga, H Drug-resistant HIV-1 prevalence in patients newly diagnosed with HIV/AIDS in Japan Antiviral Res, 2007