<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
C04-5555-6386-1 C04-5555-6386-1 Japan 2004 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15IV, G16GE, M36I, N37ND, R41K, L63T, I64V, E65D, I72V  
>C04-5555-6386-1| codons 1-99
PQITLWQRPLVTVKVEGQLKEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYD
QITVDICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gatanaga, H Drug-resistant HIV-1 prevalence in patients newly diagnosed with HIV/AIDS in Japan Antiviral Res, 2007