<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
C04-51110220-1 C04-51110220-1 Japan 2004 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F L10I, I13V, K14R, I15L, E35D, M36IV, R41K, K55R, L63P, H69K, K70R, L89M, I93V, F99L  
>C04-51110220-1| codons 1-99
PQITLWQRPIVTVRLGGQLKEALLDTGADDTVFEDVNLPGKWKPKMIGGIGGFIRVRQYD
QIPIEICGKRAIGTVLVGPTPVNIIGRNMLTQVGCTLNL

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I31T, V35T, T39K, K43E, V60I, K122E, D123S, S162C, K173R, Q174K, D177E, I178M, Q207A, R211S  
>C04-51110220-1| codons 1-240
PISPIETVPVKLKPGMDGPKVKQWPLTEEKTKALTEICKEMEEEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRRKNPEMVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Gatanaga, H Drug-resistant HIV-1 prevalence in patients newly diagnosed with HIV/AIDS in Japan Antiviral Res, 2007