<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
C04-51110202-1 C04-51110202-1 Japan 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35Q, M36I, R41K, R57K, Q61E, L63P, C67E, H69K, V82I, L89M, I93L  
>C04-51110202-1| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEQINLPGKWKPKMIGGIGGFIKVKQYD
EIPIEIEGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V21G, I31T, V35T, E40D, V60I, K122E, D123N, I135T, T165I, E169D, K173A, Q174K, I178M, T200A, K201R, I202V, Q207E, R211K  
>C04-51110202-1| codons 1-240
PISPIETVPVKLKPGMDGPKGKQWPLTEEKTKALTEICTDMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILDPFRAKNPDMVI
YQYMDDLYVGSDLEIGQHRARVEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Gatanaga, H Drug-resistant HIV-1 prevalence in patients newly diagnosed with HIV/AIDS in Japan Antiviral Res, 2007