<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
C04-51110192-1 C04-51110192-1 Japan 2004 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, E35D, M36I, R41K, L63V, I64M, H69K, L89M  
>C04-51110192-1| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIVMEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, I31T, V35T, T39K, K43E, S68G, K122E, D123N, K173I, Q174K, D177G, T200A, Q207A, R211S, K238R  
>C04-51110192-1| codons 1-240
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKTKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPGIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT

References
Author Title Citation
Gatanaga, H Drug-resistant HIV-1 prevalence in patients newly diagnosed with HIV/AIDS in Japan Antiviral Res, 2007