<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
C03-51110021-1 C03-51110021-1 Japan 2004 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, L19P, K20I, M36I, R41K, K43R, L63P, H69K, V77VI, L89M  
>C03-51110021-1| codons 1-99
PQITLWQRPIVTVKIGGQPIEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLIGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, I31T, V35T, T39M, K104N, S162A, K173A, Q174K, D177E, G196R, T200A, Q207E, R211K  
>C03-51110021-1| codons 1-240
PISPIETVPVTLKPGMDGPKVKQWPLTEEKTKALTEICMEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIRQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Gatanaga, H Drug-resistant HIV-1 prevalence in patients newly diagnosed with HIV/AIDS in Japan Antiviral Res, 2007