<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
B04-511003-1 B04-511003-1 Japan 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I L10I, K14R, N37A, R41K, D60E, L63C, H69Y, I93L  
>B04-511003-1| codons 1-99
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVIEEMALPGKWKPKMIGGIGGFIKVRQYE
QICIEICGYKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K103R, G196K, R211K, F214L  
>B04-511003-1| codons 17-252
DGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVD
FRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSIN
NETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIK
QHRTKIEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSW

References
Author Title Citation
Gatanaga, H Drug-resistant HIV-1 prevalence in patients newly diagnosed with HIV/AIDS in Japan Antiviral Res, 2007