<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, S24N, D25E, I72V, T112R, S119P, T124A, K136Q, T206S, K215R, Q216K, K219N, N222K, S230N, D253E, N254G  
>147691| codons 1-288
FLDGIDKAQEEHERYHSNWRAMANEFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKRIHTDNGPN
FTSATVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIASDIQTKELQRKITNIQKFRVYYRDNRDPLWKGPAK
LLWKGEGAVVIQEGSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    W6G, T12P, I15V, L19I, M36I, N37T, R41K, H69K, L89M, I93L  
>147691| codons 1-99
PQITLGQRPLVPIKVGGQIKEALLDTGADDTVLEEITLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, S48T, E53ED, K122E, S162H, D177E, Q207E, V245K, D250E, S251ST, A272P, L283I, P294T, E297D, Q334N, G335D, R356K, R358K, G359S, A371V, I375V, V381I, K390R, E413D, K431T, K454KR, R461K, S468T, L503I, Q509K, Q524E, E529D, L533M  
>147691| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPDNPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKETWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEVITLTDEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGNDQWTYQIYQEPFKNLKTGKYAKMKSA
HTNDVKQLTEVVQKVATESIIIWGKTPKFRLPIQKETWEAWWTEYWQATWIPDWEFVNTP
PLVKLWYQLETEPIVGAETFYVDGAANRETKLGRAGYVTDKGRQKVVTLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYAIGIIQAKPDKSESELVSQIIEELIKKDKVYMAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Nadai, Y HIV-1 epidemic in the Caribbean is dominated by subtype B. PLoS ONE, 2009