Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| AH-2773 | AH-2773 | Spain | 1999 | HIV1 | CRF02_AG | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | D4T+ NFV+ NVP | 32 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| V11I | T12S, I13V, L19I, K20I, A22T, M36I, R41K, H69K, L89M |
| >AH-2773| codons 1-99 PQITLWQRPLISVKIGGQIIETLLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF |
References
| Author | Title | Citation |
| Holguin, A | Prevalence of human immunodeficiency virus type 1 (HIV-1) Non-B subtypes in foreigners living in Madrid, Spain, and comparison of the performances of the AMPLICOR HIV-1 MONITOR version 1.0 and the new automated version 1.5. | J Clin Microbiol, 2001 |
| Holguin, A | Heterogeneous nature of HIV-1 recombinants spreading in Spain. | J Med Virol, 2005 |