<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AH-2388 AH-2388 Spain 1999 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI+ NVP 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10S, I13V, K14R, K20I, A22T, E35D, M36I, R41K, L63P, H69K, V82I, L89M  
>AH-2388| codons 1-99
PQITLWQRPSVTVRIGGQLIETLLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Holguin, A Prevalence of human immunodeficiency virus type 1 (HIV-1) Non-B subtypes in foreigners living in Madrid, Spain, and comparison of the performances of the AMPLICOR HIV-1 MONITOR version 1.0 and the new automated version 1.5. J Clin Microbiol, 2001
Holguin, A Impact of frequent natural polymorphisms at the protease gene on the in vitro susceptibility to protease inhibitors in HIV-1 non-B subtypes. J Clin Virol, 2004
Holguin, A Heterogeneous nature of HIV-1 recombinants spreading in Spain. J Med Virol, 2005