Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| AH-2388 | AH-2388 | Spain | 1999 | HIV1 | G | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+ DDI+ NVP | 28 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| L10S, I13V, K14R, K20I, A22T, E35D, M36I, R41K, L63P, H69K, V82I, L89M |
| >AH-2388| codons 1-99 PQITLWQRPSVTVRIGGQLIETLLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD QIPIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF |
References
| Author | Title | Citation |
| Holguin, A | Prevalence of human immunodeficiency virus type 1 (HIV-1) Non-B subtypes in foreigners living in Madrid, Spain, and comparison of the performances of the AMPLICOR HIV-1 MONITOR version 1.0 and the new automated version 1.5. | J Clin Microbiol, 2001 |
| Holguin, A | Impact of frequent natural polymorphisms at the protease gene on the in vitro susceptibility to protease inhibitors in HIV-1 non-B subtypes. | J Clin Virol, 2004 |
| Holguin, A | Heterogeneous nature of HIV-1 recombinants spreading in Spain. | J Med Virol, 2005 |