Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| AH-2686 | AH-2686 | Spain | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+ 3TC+ SQV | 126 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46L | Q58E | L10I, T12S, K20M, M36I, L63P, A71V |
| >AH-2686| codons 1-99 PQITLWQRPIVSIKIGGQLMEALLDTGADDTVLEEINLPGRWKPKLIGGIGGFIKVREYD QIPIEICGHKVIGTVLVGPTPVNIIGRNLLTQIGCTLNF |
References
| Author | Title | Citation |
| Wu, TD | Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. | J Virol, 2003 |
| Holguin, A | Prevalence of human immunodeficiency virus type 1 (HIV-1) Non-B subtypes in foreigners living in Madrid, Spain, and comparison of the performances of the AMPLICOR HIV-1 MONITOR version 1.0 and the new automated version 1.5. | J Clin Microbiol, 2001 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |