<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AH-430 AH-430 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ RTV+ 3TC 26

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L90M Q58E L10I, T12S, K14T, K20I, A22T, M36I, N37K, L63P, A71V  
>AH-430| codons 1-99
PQITLWQRPIVSITIGGQLIETLLDTGADDTVLEEIKLPGRWKPKLIGGIGGFIKVREYD
QIPIEICGHKVIGTVLVGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Holguin, A Prevalence of human immunodeficiency virus type 1 (HIV-1) Non-B subtypes in foreigners living in Madrid, Spain, and comparison of the performances of the AMPLICOR HIV-1 MONITOR version 1.0 and the new automated version 1.5. J Clin Microbiol, 2001
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005