<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AA059a_WG3 AA059a_WG3 Thailand 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, K14R, A21T, V31I, L45V, M50I, I72V, T112V, T124A, T125A, G134N, K136R, M154I, V165I, D167E, R187K, V201I, L234I S283G
>AA059a_WG3| codons 1-288
FLDGIDKAQEDHERYHSNWRTMASDFNLPPIVAKEIVASCDKCQVKGEAIHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWANIRQEFGIPYNPQSQGVVESINKELKKIIGQIREQAEHLKTAVQMAV
FIHNFKKKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, R41K, L63P, H69K, L89M, I93L  
>AA059a_WG3| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Rolland, M Increased HIV-1 vaccine efficacy against viruses with genetic signatures in Env V2 Nature, 2012