<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AA010a_WG11 AA010a_WG11 Thailand 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, L101I, T112I, E157Q, K160Q, V201I, S230N, D253E, D256E D116DG
>AA010a_WG11| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKIIHTGNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKQLKQIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDNRDPLWKGPAK
LLWKGEGAVVIQENSEIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12R, L33V, N37Y, I62V, L63P, I64L, H69Q  
>AA010a_WG11| codons 1-99
PQITLWQRPLVRIKIGGQLKEALLDTGADDTVVEEMYLPGRWKPKMIGGIGGFIKVRQYD
QVPLEICGQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39I, D123E, A272P, V276T, T286A, D320N, I326V, Q334L, M357T, T377Q, K390R, S468P, K530R, A554T, K558R  
>AA010a_WG11| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICIEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKTKQLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYNPSKDLVAEIQKQGLGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEAVQKIAQESIVIWGKTPKFRLPIQKETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVPLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKERVYLAWVPAHK
GIGGNEQVDKLVSTGIRRVL

References
Author Title Citation
Rolland, M Increased HIV-1 vaccine efficacy against viruses with genetic signatures in Env V2 Nature, 2012