<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, E35D, M36I, N37S, R41K, R57K, H69K, T74S, L89M  
>5137630| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEDISLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKKAIGSVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6EG, K11N, V21I, V35T, K122E, D123N, T165I, D177E, I202V, Q207A, R211N, V245Q, T286A, E291D, V292I, I293V, P294T, E312D, S322A, G335D  
>5137630| codons 1-342
PISPIGTVPVNLKPGMDGPKIKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKVEELRAHLLNWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKDPVHGVYYDPAKDLIAEIQKQGQDQWTYQIY

References
Author Title Citation
Nazziwa, J HIV-1 transmitted drug resistance and evidence of transmission clusters among recently infected antiretroviral naive individuals from Ugandan fishing communities of Lake Victoria ARHR, 2012