<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L   K20R, E35D, M36I, R41K, H69K, L89M  
>2843| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEDINLPGKWKPKLIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11T, V35T, T39K, K43E, K122E, D123S, S162C, K173R, Q174K, D177E, I178M, E203D, Q207A, R211S, K238R, V245E, T286A, E291D, I293V, E312T, V317T, I329V, G335D, M357K, R358G, G359S, K366R, K388R, K390R, A400T, T403M, N447S, D471E, Q480H, L491S, K512R, L517T, S519N, Q524E, A534S  
>2843| codons 1-560
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRRKNPEMVI
YQYMDDLYVGSDLEIGQHRTKIDELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVPLTEEAE
LELAENREILKTPVHGTYYDPSKDLIAEVQKQGQDQWTYQIYQEPFKNLKTGKYARKGSA
HTNDVRQLTEAVQKIATESIVIWGKTPRFRLPIQKETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAASRETKLGKAGYVTDRGRQKVVSLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESETVNQIIEELIKKEKVYLSWVPAHK
GIGGNEQVDKLVSAGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, K14R, V31I, V32I, I72V, T112V, T124A, T125A, G134N, I135V, K136R, D167E, G193E, V201I, D232E, L234I, D279G S283G
>2843| codons 1-288
FLDGIDKAQEDHERYHSNWRAMASDFNLPPIIAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWANVRQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGEYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSREPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDGCVAGRQDED

References
Author Title Citation
Li, L Genetic characterization and transmitted drug resistance of the HIV type 1 epidemic in men who have sex with men in Beijing, China ARHR, 2013