<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
3594043 H 3594043 H Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M Q58E L10I, K20I, M36V, N37S, R57K, I62V, L63Q, I64V, T74S  
>3594043 H| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEEVSLPGRWKPKMIGGIGGFIKVKEYD
QVQVEICGHKAIGSVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D   K103N   K11R, K20R, V60I, D121H, K122E, I135T, D177E  
>3594043 H| codons 1-177
PISPIETVPVRLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPE

References
Author Title Citation
Hawke, KG HIV non-B subtype distribution: Emerging trends and risk factors for imported and local infections newly diagnosed in South Australia ARHR, 2013