<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2991464 H 2991464 H Australia 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16GE, L19IT, K20M, M36I, N37NT, R41RK, R57K, L63H, I64IV, H69KQ, I72IT, I93L  
>2991464 H| codons 1-99
PQITLWQRPLVTIKIEGQTMEALLDTGADDTVLEEITLPGKWKPKMIGGIGGFIKVKQYD
QIHVEICGQKATGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36EA, T39D, S48T, A98S, D121DY, K122E, D123DG, E138A, S162C, K173A, Q174K, V179VI, T200A, Q207E, R211Q, P243PA, V245Q, D250E  
>2991464 H| codons 1-267
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
YEGFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAKNPDIII
YQYMDDLYVGSDLEIGQHRAKIEELREHLLQWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQAIQLPEKESWTVNDIQKLVGKLNWA

References
Author Title Citation
Hawke, KG HIV non-B subtype distribution: Emerging trends and risk factors for imported and local infections newly diagnosed in South Australia ARHR, 2013