<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2991463 H 2991463 H Australia 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19I, K20M, M36I, N37T, R41K, R57K, L63H, H69K, I93L  
>2991463 H| codons 1-99
PQITLWQRPLVTIKIGGQIMEALLDTGADDTVLEEITLPGKWKPKMIGGIGGFIKVKQYD
QIHIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39D, S48T, K101Q, K122E, D123G, E138A, T139A, S162C, K173A, Q174K, V179I, T200A, Q207EK, R211RQ, P243A, V245Q, D250E, S251SN  
>2991463 H| codons 1-267
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNAAPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRAKNPDIII
YQYMDDLYVGSDLEIGQHRAKIEELRKHLLQWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQAIQLPEKENWTVNDIQKLVGKLNWA

References
Author Title Citation
Hawke, KG HIV non-B subtype distribution: Emerging trends and risk factors for imported and local infections newly diagnosed in South Australia ARHR, 2013