<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, E35D, M36I, N37D, R41K, R57K, D60E, L63A, C67Y, H69K, L89M  
>2618286 H| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVKQYE
QIAIEIYGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K11T, V21I, V35T, V60I, D121Y, K122E, D123G, I135T, K173S, Q174K, D177E, V179I, T200A, Q207A, R211S, V245L  
>2618286 H| codons 1-267
PISPIETVPVTLKPGMDGPKIKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPILLPEKDSWTVNDIQKLVGKLNWA

References
Author Title Citation
Hawke, KG HIV non-B subtype distribution: Emerging trends and risk factors for imported and local infections newly diagnosed in South Australia ARHR, 2013