<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2134587 H 2134587 H Australia 2004 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  V75I     V35T, T39A, K49KR, I50IV, V60I, K82R, D121Y, K122E, I132L, K166KR, D177E, V179A, Q207E, F214FL, V241VI, V245K, D250E  
>2134587 H| codons 1-271
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKISRVGPENPYNTPI
FAIKKKDSTKWRKLIDFRELNRRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTLPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEIAI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
IQPIKLPEKESWTVNDIQKLVGKLNWASQIY

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13IV, I15IV, E35ED, R41K, L63P, I64IV, K70KR, I72IV  
>2134587 H| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADDTVLEDMNLPGKWKPKMIGGIGGFIKVRQYD
QIPVEICGHRAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Hawke, KG HIV non-B subtype distribution: Emerging trends and risk factors for imported and local infections newly diagnosed in South Australia ARHR, 2013