<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ED_V40 ED_V40 Venezuela 1999 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y     A98G T39A, E44D, R83K, V118I, D177E, T200R, E203ED, H208Y, R211Q  
>ED_V40| codons 36-250
EICAELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIP
HPGGLKKKKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKG
SPAIFQSSMTKILEPFRKQNPEIVIYQYMDDLYVGSDLEIGQHRRKIDELRQYLWQWGFY
TPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37S, R41K, L63P, A71AV, V77I, I93L  
>ED_V40| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMSLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Delgado, E Analysis of HIV type 1 protease and reverse transcriptase sequences from Venezuela for drug resistance-associated mutations and subtype classification: A UNAIDS study. ARHR, 2001
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005