<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ED_V24 ED_V24 Venezuela 1999 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ RTV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K65R A62AV, V75I, F116Y     V60I, S68R, D123E, I132IV, Q151X, S162CY, E169D, I178L, Q207E  
>ED_V24| codons 30-250
KIKALVEICTELEKEGKISKIGPENPYNTPIFVIKRKDRTKWRKLIDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYYSVPLDKEFRKYTAFTVPSINNETPGIRYQYNVL
PXGWKGSPAIFQCSMTKILDPFRKQNPDLVIYQYMDDLYVGSDLEIGQHRTKIEELREHL
LRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54IV, V82VA, I84IV   L10I, L19I, R57K, L63LP, A71T, I93L  
>ED_V24| codons 1-99
PQITLWQRPIVTIKIGGQIKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVKQYD
QIPIEICGHKTIGTVLVGPTPANVIGRNLLTQLGCTLNF

References
Author Title Citation
Delgado, E Analysis of HIV type 1 protease and reverse transcriptase sequences from Venezuela for drug resistance-associated mutations and subtype classification: A UNAIDS study. ARHR, 2001
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005