<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, K14R, I15V, L19T, M36I, R41K, L63P, I72V, I93L  
>YN09DH0038| codons 1-99
PQITLWQRPLVPIRVGGQTKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V60I, K101R, T107S, D121Y, K122E, K166R, K173A, D177E, V179I, V245Q, A272P, K277R, T286A, V292I, I293V  
>YN09DH0038| codons 1-298
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLRKKKSVSVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRAQNPEIII
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEIVPLTEE

References
Author Title Citation
Chen, M Genetic diversity and drug resistance among newly diagnosed and antiretroviral treatment-naive HIV-infected individuals in western Yunnan: A hot area of viral recombination in China BMC Infect Dis, 2012