Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| EV36 | EV36_idv | U.S. | 1994 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 8 |
| 2 | SQV | 48 |
| 3 | 3TC+AZT+SQV | 15 |
| 4 | None | 3 |
| 5 | IDV | 4 |
| 6 | 3TC+AZT+IDV | 15 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| G48V, I54V, V82A | L10I, T12P, L19Q, L63P, E65ED, A71T, V77I, I93IL |
| >EV36_idv| codons 1-99 PQITLWQRPIVPIKIGGQQKEALLDTGADDTVLEEMNLPGRWKPKMIVGIGGFVKVRQYD QIPIDICGHKTIGTVLIGPTPANIIGRNLLTQLGCTLNF |
References
| Author | Title | Citation |
| Kantor, R | Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. | AAC, 2002 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |