<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
EV36 EV36_sqv U.S. 1993 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 8
2 SQV 48
3 3TC+AZT+SQV 15

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V   L10I, T12P, L19Q, E35D, L63P, E65D, A71T, V77I  
>EV36_sqv| codons 1-99
PQITLWQRPIVPIKIGGQQKEALLDTGADDTVLEDMNLPGRWKPKMIVGIGGFVKVRQYD
QIPIDICGHKTIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Kantor, R Evolution of primary protease inhibitor resistance mutations during protease inhibitor salvage therapy. AAC, 2002
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005