<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TCDD-13 TCDD-13_1 Zimbabwe 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 DDI 13
2 3TC+AZT+SQV 69

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TS, I15V, L19LI, M36I, R41K, L63LAPV, H69K, V82I, L89LM, I93L L24L*
>TCDD-13_1| codons 3-99
ITLWQRPLVSIKVGGQIKEAL*DTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQI
VIEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39E, S48T, K122E, D123NS, S162SN, K173V, Q174K, D177E, T200A, Q207A  
>TCDD-13_1| codons 29-242
EKIKALTEICEEMEKEGKITKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFW
EVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNV
LPQGWKGSPAIFQNSMTKILEPFRVKNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELRAH
LLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQ

References
Author Title Citation
Kantor, R HIV-1 subtype C reverse transcriptase and protease genotypes in Zimbabwean patients failing antiretroviral therapy. ARHR, 2002
Johnston, E High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. J Virol, 2003
Kassaye, S Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. JAIDS, 2009