<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TCDD-12 TCDD-12 Zimbabwe 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 DDI 135
2 3TC+DDI 4

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TS, I15V, L19LI, M36I, R41K, L63LAPV, H69K, V82I, L89LM, I93L L24L*
>TCDD-12| codons 3-99
ITLWQRPLVSIKVGGQIKEAL*DTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQI
VIEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39D, E40ED, S48T, V60I, K122E, D123G, K173A, Q174K, D177E, Q197P, T200X, Q207E, R211K  
>TCDD-12| codons 1-244
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDDMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGPHRXKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPI

References
Author Title Citation
Kantor, R HIV-1 subtype C reverse transcriptase and protease genotypes in Zimbabwean patients failing antiretroviral therapy. ARHR, 2002
Johnston, E High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. J Virol, 2003
Kassaye, S Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. JAIDS, 2009