<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TCDD-08 TCDD-08_1 Zimbabwe 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+SQV 95

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19I, M36I, R41K, D60E, L63T, H69K, I72IT, T74S, L89M, I93L  
>TCDD-08_1| codons 4-99
TLWQRPLVTIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYEQIT
IEICGKKATGSVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35K, E36A, T39E, S48T, V60I, K173T, D177E, V179VI, T200A, Q207E, F214FL  
>TCDD-08_1| codons 29-242
EKIKALKAICEEMEKEGKITKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFW
EVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNV
LPQGWKGSPAIFQSSMTKILEPFRTQNPEIIIYQYVDDLYVGSDLEIGQHRAKIEELREH
LLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQ

References
Author Title Citation
Kantor, R HIV-1 subtype C reverse transcriptase and protease genotypes in Zimbabwean patients failing antiretroviral therapy. ARHR, 2002
Johnston, E High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. J Virol, 2003
Kassaye, S Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. JAIDS, 2009