Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| TCDD-05 | TCDD-05_1 | Zimbabwe | 2001 | HIV1 | C | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | D4T | 2 |
| 2 | 3TC+ SQV | 20 |
| 3 | 3TC+ D4T+ SQV | 18 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| L90M | T12S, I15V, L19I, M36I, R41K, L63P, H69K, A71V, I93L |
| >TCDD-05_1| codons 4-99 TLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIP IEICGKKVIGTVLVGPTPVNIIGRNLMTQLGCTLNF |
References
| Author | Title | Citation |
| Kantor, R | HIV-1 subtype C reverse transcriptase and protease genotypes in Zimbabwean patients failing antiretroviral therapy. | ARHR, 2002 |
| Johnston, E | High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. | J Virol, 2003 |
| Kassaye, S | Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. | JAIDS, 2009 |