<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TCDD-04 TCDD-04 Zimbabwe 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NVP+ NFV+ D4T 31
2 ABC+ APV+ EFV 7

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, L63P, H69K, I93L D25DN
>TCDD-04| codons 4-99
TLWQRPLVSIKVGGQIKEALLNTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIP
IEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Kantor, R HIV-1 subtype C reverse transcriptase and protease genotypes in Zimbabwean patients failing antiretroviral therapy. ARHR, 2002
Johnston, E High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. J Virol, 2003
Kassaye, S Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. JAIDS, 2009