Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| TCDD-01 | TCDD-01 | Zimbabwe | 2001 | HIV1 | C | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+ 3TC | 52 |
| 2 | NVP+ AZT+ 3TC | 12 |
| 3 | NFV+ D4T+ 3TC | 22 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| T12S, I15V, L19I, K20R, E35D, M36I, N37D, R41K, R57K, I62V, L63I, E65D, H69K, V82I, L89M, I93L |
| >TCDD-01| codons 1-99 PQITLWQRPLVSIKVGGQIREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVKQYD QVIIDICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF |
References
| Author | Title | Citation |
| Kantor, R | HIV-1 subtype C reverse transcriptase and protease genotypes in Zimbabwean patients failing antiretroviral therapy. | ARHR, 2002 |
| Johnston, E | High frequency of syncytium-inducing and CXCR4-tropic viruses among human immunodeficiency virus type 1 subtype C-infected patients receiving antiretroviral treatment. | J Virol, 2003 |
| Kassaye, S | Envelope coreceptor tropism, drug resistance, and viral evolution among subtype C HIV-1-infected individuals receiving nonsuppressive antiretroviral therapy. | JAIDS, 2009 |