<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
204240 204240 Argentina 2007 HIV1 CRF12_BF Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48GV, L90LM   L10V, T12TK, I15IV, K20KR, E34EQ, E35D, M36IV, N37ND, R41K, R57K, D60DE, Q61D, I62IV, L63LP, A71AV, T74TS, V77VI, I93L  
>204240| codons 1-99
PQITLWQRPVVKIKVGGQLREALLDTGADDTVLQDVDLPGKWKPKMIVGIGGFIKVKQYE
DVPIEICGHKVIGSVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Jones, LR Drug resistance mutations in HIV pol sequences from Argentinean patients under antiretroviral treatment: subtype, gender, and age issues. ARHR, 2012