<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70KR, M184V, T215TNSY D67DG, K219KE, N348I     S68SG, I135IM, I142T, R211K, V245E, A272P, K277R, V292I, I293V, E297A, S322A, A360AT, A376S, T377H, T386I, K390R  
>201412| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKGGTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSMNNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDEKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEIVPLTAEAE
LELAENREILKEPVHGVYYDPAKDLIAEIQKQGQGQWTYQIYQEPFKILKTGKYARMRGT
HTNDVKQLTEAVQKISHESIVIWGKIPKFRLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M L23LI T4S, L19I, K20KM, E35G, M36I, I62V, L63P, H69Q, K70E, A71AT, Q92QK  
>201412| codons 1-99
PQISLWQRPLVTIKIGGQIMEAILDTGADDTVLEGINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGQETIGTVLVGPTPVNIIGRNLMTKIGCTLNF

References
Author Title Citation
Jones, LR Drug resistance mutations in HIV pol sequences from Argentinean patients under antiretroviral treatment: subtype, gender, and age issues. ARHR, 2012