<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JS11 JS98491 Luxembourg 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 IDV 108

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82F   L10I, K14R, I62V, L63S, C67D, H69K, A71V, V77I, I93L  
>JS98491| codons 4-99
TLWQRPIVTIRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFVKVRQYDQVS
IEIDGKKVIGTVLIGPTPFNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210W, T215Y V75M     V35I, T39A, V60I, D121H, K122E, D123S, I135T, I142V, K173S, Q174K, D177E, V179I, T200A, Q207A, R211N, L228R, V245I, D250E I31K
>JS98361| codons 25-252
PLTEEKKKALIEICAELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLMDFRELNKRT
QDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLHESFRKYTAFTIPSTNNETPGVRY
QYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEIIIYQYMDDLYVGSDLEIGQHRAKIEE
LRAHLWNWGFYTPDKKHQKEPPFRWMGYELHPDKWTVQPIILPEKESW

References
Author Title Citation
Servais, J Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. J Clin Microbiol, 2001