Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| JS26 | JS98292 | Luxembourg | 1998 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | NVP+ AZT+ SQV+ 3TC | 88 |
| 2 | DDI+ NVP+ D4T | 12 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46I, L90M | L10F, G73S | L19I, E35D, M36I, D60E, Q61E, I62V, L63P, A71T, I72T |
| >JS98292| codons 4-99 TLWQRPFVTIKIGGQIKEALLDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYEEVP IEICGHKTTSTVLVGPTPVNIIGRNLMTQIGCTLNF |
References
| Author | Title | Citation |
| Servais, J | Comparison of DNA sequencing and a line probe assay for detection of human immunodeficiency virus type 1 drug resistance mutations in patients failing highly active antiretroviral therapy. | J Clin Microbiol, 2001 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |